Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-NR1I2 Mouse Monoclonal Antibody

Gyártó: Abnova
Mouse monoclonal antibody raised against a full-length recombinant NR1I2.

Type: Primary
Antigen: NR1I2
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Kérjük jelentkezzen be a saját árak és készletadatok megtekintéséhez!
  Remember me on this device
 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
Up to 5 Clones 1 ABNOH00008856-M
Vonalkód generálása Barcode Label Format: 
PDF katalógus oldal generálása

SPECIFIKÁCIÓK

Antigen symbol NR1I2
Antigen name Nuclear receptor subfamily 1, group I, member 2
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms PAR2, PRR, SXR, PAR1, ONR1, BXR, PARq, PAR, PXR, SAR
Amino acid number 1 to 434
Gene ID 8856
Méret Liquid
Cross Adsorption No
Immunogen NR1I2 (NP_003880.3, 1 a.a. ~ 434 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Szekvencia MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség