Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-HS3ST1 Mouse Monoclonal Antibody

Gyártó: Abnova
Mouse monoclonal antibody raised against a full-length recombinant HS3ST1.

Type: Primary
Antigen: HS3ST1
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Kérjük jelentkezzen be a saját árak és készletadatok megtekintéséhez!
  Remember me on this device
 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
Up to 5 Clones 1 ABNOH00009957-M
Vonalkód generálása Barcode Label Format: 
PDF katalógus oldal generálása

SPECIFIKÁCIÓK

Antigen symbol HS3ST1
Antigen name heparan sulfate (glucosamine) 3-O-sulfotransferase 1
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms 3OST, 3OST1
Amino acid number 1 to 307
Gene ID 9957
Méret Liquid
Cross Adsorption No
Immunogen HS3ST1 (NP_005105.1, 1 a.a. ~ 307 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Szekvencia MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség