Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SPR Mouse Monoclonal Antibody [clone: 4F2]

Gyártó: US Biological
Type: Primary
Antigen: SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))
Clonality: monoclonal
Clone: 4F2
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133799
Vonalkód generálása Barcode Label Format: 
PDF katalógus létrehozása

SPECIFIKÁCIÓK

Antigen symbol SPR
Antigen name sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 4F2
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
ImmunoPrecipitation Yes
Amino acid number 164 to 261
Purification purified by Protein A chromatography
Szekvencia FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD*
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping