Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SPINK1 Mouse Monoclonal Antibody [clone: 4D4]

Gyártó: US Biological
Recommended dilution: Immunochemistry: 1 μg/ml

Type: Primary
Antigen: SPINK1 (serine peptidase inhibitor, Kazal type 1)
Clonality: monoclonal
Clone: 4D4
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Kérjük jelentkezzen be a saját árak és készletadatok megtekintéséhez!
  Remember me on this device
 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133774
Vonalkód generálása Barcode Label Format: 
PDF katalógus oldal generálása

SPECIFIKÁCIÓK

Antigen symbol SPINK1
Antigen name Serine Peptidase Inhibitor, Kazal Type 1
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 4D4
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
ImmunoPrecipitation Yes
Purification purified by Protein A chromatography
Szekvencia DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC*
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség