Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-ATL1 Mouse Monoclonal Antibody [clone: 1B9]

Gyártó: US Biological
Type: Primary
Antigen: ATL1 (atlastin GTPase 1)
Clonality: monoclonal
Clone: 1B9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human, Rat



Kérjük jelentkezzen be a saját árak és készletadatok megtekintéséhez!
  Remember me on this device
 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133762
Vonalkód generálása Barcode Label Format: 
PDF katalógus oldal generálása

SPECIFIKÁCIÓK

Antigen symbol ATL1
Antigen name atlastin GTPase 1
Reactivity Rat, Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1B9
Host Mouse
Isotype IgG1 kappa
Western blot Yes
ELISA Yes
Amino acid number 1 to 101
Purification purified by Protein A chromatography
Szekvencia MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség