Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Gyártó: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133736
Vonalkód generálása Barcode Label Format: 
PDF katalógus létrehozása

SPECIFIKÁCIÓK

Antigen symbol SP3
Antigen name Sp3 transcription factor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3H7
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 516 to 616
Purification purified by Protein A chromatography
Szekvencia GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping