Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SOX10 Mouse Monoclonal Antibody [clone: 1E6]

Gyártó: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SOX10 (SRY (sex determining region Y)-box 10)
Clonality: monoclonal
Clone: 1000000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133713
Vonalkód generálása Barcode Label Format: 
PDF katalógus létrehozása

SPECIFIKÁCIÓK

Antigen symbol SOX10
Antigen name SRY (sex determining region Y)-box 10
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1E6
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 336 to 434
Purification purified by Protein A chromatography
Szekvencia KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR*
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség
 

Új megjelenés és megújult elkötelezettség

A már jól ismert funkciók és erőforrások alapján, az Avantor® innovatív megoldásaival optimalizálva. Új márkánk agilitást és az új ügyféligényekhez való alkalmazkodási képességünket szimbolizálja.

TUDJON MEG TÖBBET VÁSÁRLÁS