Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SOHLH2 Rabbit Polyclonal Antibody

Gyártó: US Biological
Type: Primary
Antigen: SOHLH2 (spermatogenesis and oogenesis specific basic helix-loop-helix 2)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human



 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µl 100 µl USBI133698
Vonalkód generálása Barcode Label Format: 
PDF katalógus létrehozása

SPECIFIKÁCIÓK

Antigen symbol SOHLH2
Antigen name spermatogenesis and oogenesis specific basic helix-loop-helix 2
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Rabbit
Isotype IgG
Western blot Yes
ImmunoPrecipitation Yes
Méret Serum
Szekvencia MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Form liquid
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség
 

Új megjelenés és megújult elkötelezettség

A már jól ismert funkciók és erőforrások alapján, az Avantor® innovatív megoldásaival optimalizálva. Új márkánk agilitást és az új ügyféligényekhez való alkalmazkodási képességünket szimbolizálja.

TUDJON MEG TÖBBET VÁSÁRLÁS