Folytatni kívánja a munkamenetet?
Kilépés 
A munkamenet lejárt
A munkamenet lejárt. Biztonsági okokból kijelentkeztettük.
Szeretne újra bejelentkezni?

Anti-SOCS3 Mouse Monoclonal Antibody [clone: 1E4]

Gyártó: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml; Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SOCS3 (suppressor of cytokine signaling 3)
Clonality: monoclonal
Clone: 10000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human



 

RENDELÉS

Többet mutat / Kevesebbet mutat
Méret M.egys VWR katalógus szám Mennyiség
100 µg 100 µG USBI133684
Vonalkód generálása Barcode Label Format: 
PDF katalógus létrehozása

SPECIFIKÁCIÓK

Antigen symbol SOCS3
Antigen name Suppressor of Cytokine Signaling 3
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1E4
Host Mouse
Isotype IgG2b kappa
ELISA Yes
ImmunoFluorescence Yes
Purification purified by Protein A chromatography
Szekvencia MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Form liquid
Storage buffer PBS, pH 7,2.
Tárolási hőmérséklet Cool
Shipping temperature Ice
Adja meg a részleteket

Válassza ki a cikket, amihez tanúsítványt keres.

Kérjük, adja meg a sarzs számot! A mező kitöltése kötelező, ismeretlen szám esetén használjon x-et.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Vagy
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Leírás Katalógusszám Availability Egység Az Ön ára Price Per Mennyiség
 

Új megjelenés és megújult elkötelezettség

A már jól ismert funkciók és erőforrások alapján, az Avantor® innovatív megoldásaival optimalizálva. Új márkánk agilitást és az új ügyféligényekhez való alkalmazkodási képességünket szimbolizálja.

TUDJON MEG TÖBBET VÁSÁRLÁS